ASXL2 Antibody - middle region : Biotin

ASXL2 Antibody - middle region : Biotin
Artikelnummer
AVIARP57184_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax (see MIM 159555) and polycomb (see MIM 610231) (ETP) gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing (Katoh and Katoh, 2003 [PubMed 12888926]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASXL2

Molecular Weight: 154kDa

Peptide Sequence: Synthetic peptide located within the following region: EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative Polycomb group protein ASXL2

Protein Size: 1435

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57184_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57184_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55252
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×