ATG16L1 Antibody - N-terminal region : HRP

ATG16L1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54268_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1

Key Reference: Hancock,L., (er) Inflamm. Bowel Dis. (2008) In press

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Autophagy-related protein 16-1

Protein Size: 588

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54268_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54268_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55054
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×