ATP6V0D2 Antibody - middle region : FITC

ATP6V0D2 Antibody - middle region : FITC
Artikelnummer
AVIARP55487_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2

Key Reference: Fridy,P.C., (2003) Biol. Cell 95 (7), 453-457

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase subunit d 2

Protein Size: 350

Purification: Affinity Purified

Subunit: d 2
Mehr Informationen
Artikelnummer AVIARP55487_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55487_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 245972
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×