ATP6V0D2 Antibody - middle region : HRP

ATP6V0D2 Antibody - middle region : HRP
Artikelnummer
AVIARP55488_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2

Key Reference: Nishi,T. (2003) Biol. Cell 95 (7), 453-457

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-type proton ATPase subunit d 2

Protein Size: 350

Purification: Affinity Purified

Subunit: d 2
Mehr Informationen
Artikelnummer AVIARP55488_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55488_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 245972
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×