ATP6V1A Antibody - N-terminal region : HRP

ATP6V1A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56324_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1A

Key Reference: Lu,M., (2007) J. Biol. Chem. 282 (34), 24495-24503

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-type proton ATPase catalytic subunit A

Protein Size: 617

Purification: Affinity Purified

Subunit: A
Mehr Informationen
Artikelnummer AVIARP56324_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56324_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 523
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×