ATP6V1B1 Antibody - middle region : Biotin

ATP6V1B1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56327_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1B1

Key Reference: 0

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase subunit B

Protein Size: 513

Purification: Affinity Purified

Subunit: B, kidney isoform
Mehr Informationen
Artikelnummer AVIARP56327_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56327_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 525
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×