ATP6V1B1 Antibody - middle region : HRP

ATP6V1B1 Antibody - middle region : HRP
Artikelnummer
AVIARP56327_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1B1

Key Reference: 0

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-type proton ATPase subunit B

Protein Size: 513

Purification: Affinity Purified

Subunit: B, kidney isoform
Mehr Informationen
Artikelnummer AVIARP56327_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56327_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 525
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×