Atp6v1b1 Antibody - N-terminal region : Biotin

Atp6v1b1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56326_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp6v1b1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: PRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTLPDGTQRSGQVLEVAGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATPase, H+ transporting, lysosomal V1 subunit B1 EMBL AAH17127.1

Protein Size: 513

Purification: Affinity Purified

Subunit: B, kidney isoform
Mehr Informationen
Artikelnummer AVIARP56326_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56326_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 110935
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×