Atp6v1b1 Antibody - N-terminal region : HRP

Atp6v1b1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56326_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp6v1b1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: PRVTYRTVCSVNGPLVVLDQVKFAQYAEIVNFTLPDGTQRSGQVLEVAGT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ATPase, H+ transporting, lysosomal V1 subunit B1 EMBL AAH17127.1

Protein Size: 513

Purification: Affinity Purified

Subunit: B, kidney isoform
Mehr Informationen
Artikelnummer AVIARP56326_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56326_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 110935
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×