ATPAF1 Antibody - N-terminal region : FITC

ATPAF1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57651_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATPAF1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATP synthase mitochondrial F1 complex assembly factor 1 Ensembl ENSP00000330685

Protein Size: 260

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57651_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57651_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64756
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×