ATXN7L1 Antibody - middle region : FITC

ATXN7L1 Antibody - middle region : FITC
Artikelnummer
AVIARP55521_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of ATXN7L1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATXN7L1

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ataxin 7-like 4, isoform CRA_a EMBL EAW83370.1

Protein Size: 146

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55521_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55521_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222255
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×