ATXN7L1 Antibody - middle region : HRP

ATXN7L1 Antibody - middle region : HRP
Artikelnummer
AVIARP55521_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of ATXN7L1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATXN7L1

Key Reference: Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ataxin 7-like 4, isoform CRA_a EMBL EAW83370.1

Protein Size: 146

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55521_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55521_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 222255
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×