AURKA Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: AURKA is a cell cycle-regulated kinase that appears to be involved in microtubule formation and/or stabilization at the spindle pole during chromosome segregation. It is found at the centrosome in interphase cells and at the spindle poles in mitosis. This protein may play a role in tumor development and progression. A processed pseudogene of this gene has been found on chromosome 1, and an unprocessed pseudogene has been found on chromosome 10. Multiple transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human AURKA

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: REKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Aurora kinase A

Protein Size: 403

Purification: Affinity Purified

• Artikelnummer: AVIARP53574_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53574_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6790
• Wirt: Rabbit
• Konjugat: Conjugated, HRP