AURKC Antibody : HRP

AURKC Antibody : HRP
Artikelnummer
AVIARP53573_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Molecular Weight: 36 kDa

Peptide Sequence: Synthetic peptide located within the following region: PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Aurora kinase C

Protein Size: 309

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53573_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53573_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Human Gene ID 6795
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×