AURKC Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines, suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AURKC

Key Reference: Lim,J., (2007) Cell Cycle 6 (20), 2579-2580

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aurora kinase C

Protein Size: 309

Purification: Affinity Purified

• Artikelnummer: AVIARP53575_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53575_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6795
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin