Avil Antibody - N-terminal region

Description of Target: Avil is a Ca2+-regulated actin-binding protein. It may have a unique function in the morphogenesis of neuronal cells which form ganglia. It is required for SREC1-mediated regulation of neurite-like outgrowth. It plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. It is involved in the formation of long fine actin-containing filopodia-like structures in fibroblast and is required for SREC1-mediated regulation of neurite-like outgrowth. Avil plays a role in ciliogenesis.

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: SGERLXXXXXXKAMLLAKDIRDREGGGRAEIGVIEGDKEAASPELMTVLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Protein Name: Advillin

Protein Size: 829

Purification: Affinity Purified

• Artikelnummer: AVIARP31494_P050-25
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP31494_P050-25UL
• Verpackungseinheit: 25µl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79253
• Wirt: Rabbit
• Konjugat: Unconjugated