AXUD1 Antibody - middle region : FITC

AXUD1 Antibody - middle region : FITC
Artikelnummer
AVIARP57693_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AXUD1

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 589

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57693_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57693_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64651
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×