B2M Antibody - N-terminal region : Biotin

B2M Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56555_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M

Key Reference: Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-2-microglobulin

Protein Size: 119

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56555_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56555_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 567
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×