Bloc1s2 Antibody - N-terminal region : HRP

Bloc1s2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55703_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Bloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking.

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 2

Protein Size: 143

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP55703_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55703_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 73689
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×