BLVRB Antibody - middle region : Biotin

BLVRB Antibody - middle region : Biotin
Artikelnummer
AVIARP56121_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLVRB

Key Reference: Smith,L.J., (2008) Biochem. J. 411 (3), 475-484

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Flavin reductase (NADPH)

Protein Size: 206

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56121_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56121_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 645
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×