BMP5 antibody

BMP5 antibody
Artikelnummer
GTX03273-100
Verpackungseinheit
100 μg
Hersteller
GeneTex

Verfügbarkeit: wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. IHC-P: 0.5-1μg/ml. FCM: 1-3μg/1x10⁶ cells. ELISA: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.

Calculated MW: 52

Form: Liquid

Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg Sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which plays a role in bone and cartilage development. Polymorphisms in this gene may be associated with osteoarthritis in human patients. This gene is differentially regulated in multiple human cancers. This gene encodes distinct protein isoforms that may be similarly proteolytically processed. [provided by RefSeq, Jul 2016]

Uniprot ID: P22003

Antigen Species: Human

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Purification: Purified by antigen-affinity chromatography

Conjugation: Unconjugated

Full Name: bone morphogenetic protein 5
Mehr Informationen
Artikelnummer GTX03273-100
Hersteller GeneTex
Hersteller Artikelnummer GTX03273-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Polyclonal
Methode Immunohistochemistry (paraffin), Western Blotting, ELISA, Flow Cytometry
Isotyp IgG
Human Gene ID 653
Wirt Rabbit
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF)
×