BPGM Antibody - C-terminal region : FITC

BPGM Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58218_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BPGM

Key Reference: Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Bisphosphoglycerate mutase

Protein Size: 259

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58218_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58218_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 669
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×