BPGM Antibody - middle region : HRP

BPGM Antibody - middle region : HRP
Artikelnummer
AVIARP58217_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BPGM

Key Reference: Wang,Y., (2006) J. Biol. Chem. 281 (51), 39642-39648

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bisphosphoglycerate mutase

Protein Size: 259

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58217_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58217_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 669
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×