BTG4 Antibody - middle region : HRP

BTG4 Antibody - middle region : HRP
Artikelnummer
AVIARP56981_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTG4

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein BTG4

Protein Size: 223

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56981_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56981_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54766
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×