C10orf132 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C10orf132 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgin subfamily A member 7B

Protein Size: 167

Purification: Affinity Purified

• Artikelnummer: AVIARP54406_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54406_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 401647
• Wirt: Rabbit
• Konjugat: Conjugated, FITC