C10orf132 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C10orf132 remains unknown.

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: TEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgin subfamily A member 7B

Protein Size: 167

Purification: Affinity Purified

• Artikelnummer: AVIARP54405_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54405_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 401647
• Wirt: Rabbit
• Konjugat: Conjugated, HRP