C10orf56 Antibody - middle region : Biotin

C10orf56 Antibody - middle region : Biotin
Artikelnummer
AVIARP55587_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of C10orf56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf56

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 24

Protein Size: 241

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55587_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55587_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219654
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×