C10orf96 Antibody - middle region : Biotin

C10orf96 Antibody - middle region : Biotin
Artikelnummer
AVIARP55892_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf96

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 172

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55892_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55892_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374355
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×