C11orf53 Antibody - middle region : FITC

C11orf53 Antibody - middle region : FITC
Artikelnummer
AVIARP55885_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf53

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C11orf53

Protein Size: 236

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55885_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55885_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 341032
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×