C11orf77 Antibody - middle region : FITC

C11orf77 Antibody - middle region : FITC
Artikelnummer
AVIARP55708_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf77

Key Reference: Sinzelle,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (12), 4715-4720

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative nuclease HARBI1

Protein Size: 349

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55708_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55708_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283254
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×