C12orf4 Antibody - middle region : FITC

C12orf4 Antibody - middle region : FITC
Artikelnummer
AVIARP57399_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C12orf4

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf4

Protein Size: 552

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57399_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57399_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57102
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×