C12orf40 Antibody - N-terminal region : FITC

C12orf40 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54472_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C12orf40 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C12orf40

Protein Size: 652

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54472_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54472_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283461
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×