C12orf40 Antibody - N-terminal region : HRP

C12orf40 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54472_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C12orf40 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C12orf40

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C12orf40

Protein Size: 652

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54472_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54472_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283461
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×