C13orf30 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C13orf30

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM216B

Protein Size: 139

Purification: Affinity Purified

• Artikelnummer: AVIARP53425_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53425_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 144809
• Wirt: Rabbit
• Konjugat: Conjugated, FITC