C14orf104 Antibody - N-terminal region : Biotin

C14orf104 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57125_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf104

Key Reference: 0

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kintoun

Protein Size: 837

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57125_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57125_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55172
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×