C14orf104 Antibody - N-terminal region : HRP

C14orf104 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57125_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf104

Key Reference: 0

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein kintoun

Protein Size: 837

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57125_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57125_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 55172
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×