C14orf140 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf140

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger C2HC domain-containing protein 1C

Protein Size: 275

Purification: Affinity Purified

• Artikelnummer: AVIARP53770_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53770_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79696
• Wirt: Rabbit
• Konjugat: Conjugated, HRP