C14orf177 Antibody - N-terminal region : FITC

C14orf177 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55821_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of C14orf177 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf177

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein C14orf177

Protein Size: 125

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55821_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55821_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283598
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×