C16orf61 Antibody - middle region : FITC

C16orf61 Antibody - middle region : FITC
Artikelnummer
AVIARP57367_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf61

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COX assembly mitochondrial protein 2 homolog

Protein Size: 79

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57367_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57367_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56942
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×