C16orf65 Antibody - middle region : Biotin

C16orf65 Antibody - middle region : Biotin
Artikelnummer
AVIARP55697_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ domain-containing protein 9

Protein Size: 202

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55697_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55697_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255762
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×