C16orf65 Antibody - middle region : HRP

C16orf65 Antibody - middle region : HRP
Artikelnummer
AVIARP55697_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PDZ domain-containing protein 9

Protein Size: 202

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55697_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55697_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255762
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×