C17orf39 Antibody - C-terminal region : Biotin

C17orf39 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53761_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of C17orf39 remains unknown.The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39

Key Reference: Bi,W., (2002) Genome Res. 12 (5), 713-728

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose-induced degradation protein 4 homolog

Protein Size: 300

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53761_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53761_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79018
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×