C17orf39 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39

Key Reference: Bi,W., (2002) Genome Res. 12 (5), 713-728

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glucose-induced degradation protein 4 homolog

Protein Size: 300

Purification: Affinity Purified

• Artikelnummer: AVIARP53762_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53762_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79018
• Wirt: Rabbit
• Konjugat: Conjugated, HRP