C17orf48 Antibody - middle region : FITC

C17orf48 Antibody - middle region : FITC
Artikelnummer
AVIARP57377_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C17orf48

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase

Protein Size: 342

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57377_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57377_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56985
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×