C17orf48 Antibody - N-terminal region : FITC

C17orf48 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57376_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C17orf48

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase

Protein Size: 342

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57376_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57376_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56985
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×