C17orf78 Antibody - middle region : Biotin

C17orf78 Antibody - middle region : Biotin
Artikelnummer
AVIARP55673_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of the protein encoded by this gene is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C17orf78

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C17orf78

Protein Size: 275

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55673_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55673_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284099
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×