C17orf97 Antibody - N-terminal region : HRP

C17orf97 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54431_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of LOC400566 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC400566

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C17orf97

Protein Size: 433

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54431_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54431_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 400566
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×