C19orf62 Antibody - N-terminal region : FITC

C19orf62 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54986_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C19orf62 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BRISC and BRCA1-A complex member 1

Protein Size: 329

Purification: Affinity Purified

Subunit: MERIT40
Mehr Informationen
Artikelnummer AVIARP54986_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54986_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29086
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×