C19orf62 Antibody - N-terminal region : HRP

C19orf62 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54986_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C19orf62 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BRISC and BRCA1-A complex member 1

Protein Size: 329

Purification: Affinity Purified

Subunit: MERIT40
Mehr Informationen
Artikelnummer AVIARP54986_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54986_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29086
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×