C1orf102 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf102

Key Reference: Kobayashi,Y., (2005) J. Biol. Chem. 280 (37), 32332-32339

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein OSCP1

Protein Size: 389

Purification: Affinity Purified

• Artikelnummer: AVIARP53512_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53512_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 127700
• Wirt: Rabbit
• Konjugat: Conjugated, FITC